PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001291G0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 313aa    MW: 34018.7 Da    PI: 8.3601
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001291G0040genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.47.1e-2587131145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr++++++k+CE+H+hrg++rsrk++e+
  PH01001291G0040  87 DPEPGRCRRTDGKKWRCSREAYGDSKYCEKHMHRGKNRSRKPVET 131
                      79****************************************985 PP

2QLQ56.77.5e-201448236
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                      F a+Q+q+L++Q+l+y+y+aa+ PvPp+L+++++
  PH01001291G0040 14 LFKASQWQELEHQALIYRYMAAGTPVPPDLVLPLR 48
                     599******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.4E-81349IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.071449IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.0E-141547IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.80387131IPR014977WRC domain
PfamPF088793.7E-2088130IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MMLSGQGSGG GRCLFKASQW QELEHQALIY RYMAAGTPVP PDLVLPLRHR DGFAIDTATS  60
LAFPPHQPSL GWGCYGAAAQ CGRKAEDPEP GRCRRTDGKK WRCSREAYGD SKYCEKHMHR  120
GKNRSRKPVE TMSSSAGAGA SYVPSALSIS PPAPDASSYG HQHHLGRPDA SPARASSQIS  180
PLQLRLDAAA HATSPPSSYH RYAQYSTSPL FPSGYGYGSS KEHDESEVRR RQHFLAFGAD  240
LSRDKPAAAG HDAAAATEKP LRRFFDEWPR ETSDGRPWMG ADQDETQLSI SIPTALPDLA  300
VAATSRYYNA DE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8361982e-93CT836198.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA059E01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964939.11e-111PREDICTED: growth-regulating factor 2-like isoform X2
RefseqXP_004964938.11e-111PREDICTED: growth-regulating factor 2-like isoform X1
SwissprotQ6AWY71e-106GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLA0A0E0PUU31e-112A0A0E0PUU3_ORYRU; Uncharacterized protein
STRINGSi006922m1e-110(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139922527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-47growth-regulating factor 5